DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment agt and Mgmt

DIOPT Version :9

Sequence 1:NP_001303422.1 Gene:agt / 40816 FlyBaseID:FBgn0024912 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_036993.1 Gene:Mgmt / 25332 RGDID:3087 Length:209 Species:Rattus norvegicus


Alignment Length:98 Identity:38/98 - (38%)
Similarity:54/98 - (55%) Gaps:9/98 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 SQAIPI-AIYGTDFQLS------VWRALVHMKRGETCTYSQLAERMGRPTAVRAVASAVAKNELA 158
            ::.:|: |::...||..      :|:.|..:|.||..:|.|||...|.|.|.|||..|:..|.:.
  Rat    80 TEGLPLPALHHPVFQQDSFTRQVLWKLLKVVKFGEMVSYQQLAALAGNPKAARAVGGAMRSNPVP 144

  Fly   159 ILIPCHRVVSQNGA-SKYHWGA-ALKQLLLADE 189
            ||||||||:..:|| ..|..|. .:|:.|||.|
  Rat   145 ILIPCHRVIRSDGAIGNYSGGGQTVKEWLLAHE 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
agtNP_001303422.1 AdaB 22..190 CDD:223427 38/98 (39%)
ATase 111..189 CDD:392118 35/85 (41%)
MgmtNP_036993.1 AdaB 6..178 CDD:223427 38/98 (39%)
Methyltransf_1N 6..94 CDD:280944 2/13 (15%)
ogt 97..177 CDD:273157 33/79 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349082
Domainoid 1 1.000 61 1.000 Domainoid score I10244
eggNOG 1 0.900 - - E1_COG0350
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1573162at2759
OrthoFinder 1 1.000 - - FOG0004341
OrthoInspector 1 1.000 - - oto96880
orthoMCL 1 0.900 - - OOG6_101199
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.610

Return to query results.
Submit another query.