DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment agt and agt-1

DIOPT Version :9

Sequence 1:NP_001303422.1 Gene:agt / 40816 FlyBaseID:FBgn0024912 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001041054.1 Gene:agt-1 / 190454 WormBaseID:WBGene00000093 Length:175 Species:Caenorhabditis elegans


Alignment Length:80 Identity:39/80 - (48%)
Similarity:53/80 - (66%) Gaps:1/80 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 TDFQLSVWRALVHMKRGETCTYSQLAERMGRPTAVRAVASAVAKNELAILIPCHRVVSQNG-ASK 174
            |.|.:.|:.|:..:.:|||.:||.:|..:|.|:||||||||.|:|.||.::|||||:...| .|.
 Worm    87 TAFGMQVYSAIQKIPKGETRSYSDIAREIGNPSAVRAVASACARNNLAYIVPCHRVIGSTGNLSG 151

  Fly   175 YHWGAALKQLLLADE 189
            |.||.|.|:.||..|
 Worm   152 YRWGIAKKRRLLQAE 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
agtNP_001303422.1 AdaB 22..190 CDD:223427 39/80 (49%)
ATase 111..189 CDD:392118 38/78 (49%)
agt-1NP_001041054.1 DNA_binding_1 88..168 CDD:376440 38/79 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165442
Domainoid 1 1.000 77 1.000 Domainoid score I5777
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3428
OMA 1 1.010 - - QHG49457
OrthoDB 1 1.010 - - D1573162at2759
OrthoFinder 1 1.000 - - FOG0004341
OrthoInspector 1 1.000 - - oto19925
orthoMCL 1 0.900 - - OOG6_101199
Panther 1 1.100 - - LDO PTHR10815
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2186
SonicParanoid 1 1.000 - - X13449
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.840

Return to query results.
Submit another query.