DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twr and IMP1

DIOPT Version :9

Sequence 1:NP_649676.1 Gene:twr / 40815 FlyBaseID:FBgn0262801 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_013870.1 Gene:IMP1 / 855182 SGDID:S000004758 Length:190 Species:Saccharomyces cerevisiae


Alignment Length:128 Identity:31/128 - (24%)
Similarity:47/128 - (36%) Gaps:53/128 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 VTGSESPIVVVLSGSMEPAFHRGDLLFLTNYKEEPVRVGEIVVFKVEGRDIPIVHRVIKLHEKED 112
            |||....:|:|            |...:.||      ||:::|      |.......||:.|   
Yeast    86 VTGMPGDLVLV------------DPSTIVNY------VGDVLV------DEERFGTYIKVPE--- 123

  Fly   113 GSVKFLTKGDN--NNVDDRGLYAPNQLWLTKKDIVGRARGFLPYVGII---TIFMNEYPKVKW 170
            |.| ::| |||  :::|.|...|                  || :|:|   .:..|.:.|..|
Yeast   124 GHV-WVT-GDNLSHSLDSRTYNA------------------LP-MGLIMGKIVAANNFDKPFW 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twrNP_649676.1 Peptidase_S24_S26 28..181 CDD:415851 31/128 (24%)
IMP1NP_013870.1 sigpep_I_bact 38..155 CDD:274044 28/116 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.