DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twr and IMP2

DIOPT Version :9

Sequence 1:NP_649676.1 Gene:twr / 40815 FlyBaseID:FBgn0262801 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_013749.1 Gene:IMP2 / 855051 SGDID:S000004638 Length:177 Species:Saccharomyces cerevisiae


Alignment Length:54 Identity:20/54 - (37%)
Similarity:26/54 - (48%) Gaps:8/54 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 KFLTKGDNN-NVDDRGLY-APNQLWLTKKDIVGRARGFLPYVGIITIFMNEYPK 167
            ||..|..:| :.||..|: ||..   .:|....|.:| ||:..|.|.|  .|||
Yeast    62 KFGVKNPSNLSRDDIILFKAPTN---PRKVYCKRVKG-LPFDTIDTKF--PYPK 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twrNP_649676.1 Peptidase_S24_S26 28..181 CDD:415851 20/54 (37%)
IMP2NP_013749.1 S26_SPase_I 34..147 CDD:119398 20/54 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.