DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twr and AT1G52600

DIOPT Version :9

Sequence 1:NP_649676.1 Gene:twr / 40815 FlyBaseID:FBgn0262801 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_175669.1 Gene:AT1G52600 / 841692 AraportID:AT1G52600 Length:180 Species:Arabidopsis thaliana


Alignment Length:178 Identity:103/178 - (57%)
Similarity:129/178 - (72%) Gaps:2/178 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IDEMLGDFNRMNKRQSLYQVLSFAMIVSSALMIWKGLMVVTGSESPIVVVLSGSMEPAFHRGDLL 73
            |.|.:.....:..||...|.:|..|||:|||:|||.||.|||||||:||||||||||.|.|||:|
plant     4 IGETVDSIKSIQIRQLFTQAISLGMIVTSALIIWKALMCVTGSESPVVVVLSGSMEPGFKRGDIL 68

  Fly    74 FLTNYKEEPVRVGEIVVFKVEGRDIPIVHRVIKLHEKED-GSVKFLTKGDNNNVDDRGLYAPNQL 137
            || :..::|:|.||||||.|:||||||||||||:||:|: |.|..|||||||..|||.|||..||
plant    69 FL-HMSKDPIRAGEIVVFNVDGRDIPIVHRVIKVHERENTGEVDVLTKGDNNYGDDRLLYAEGQL 132

  Fly   138 WLTKKDIVGRARGFLPYVGIITIFMNEYPKVKWAILSILAIFVLLHRE 185
            ||.:..|:|||.|||||||.:||.|.|.|.:|:.::..|.:.|:..::
plant   133 WLHRHHIMGRAVGFLPYVGWVTIIMTEKPIIKYILIGALGLLVITSKD 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twrNP_649676.1 Peptidase_S24_S26 28..181 CDD:415851 97/153 (63%)
AT1G52600NP_175669.1 Peptidase_S24_S26 24..176 CDD:415851 97/152 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 81 1.000 Domainoid score I2958
eggNOG 1 0.900 - - E1_COG0681
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 200 1.000 Inparanoid score I1317
OMA 1 1.010 - - QHG54172
OrthoDB 1 1.010 - - D1486616at2759
OrthoFinder 1 1.000 - - FOG0001985
OrthoInspector 1 1.000 - - otm3133
orthoMCL 1 0.900 - - OOG6_100807
Panther 1 1.100 - - LDO PTHR10806
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1299
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.