DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twr and PLSP1

DIOPT Version :10

Sequence 1:NP_649676.1 Gene:twr / 40815 FlyBaseID:FBgn0262801 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_189102.3 Gene:PLSP1 / 822055 AraportID:AT3G24590 Length:310 Species:Arabidopsis thaliana


Alignment Length:131 Identity:34/131 - (25%)
Similarity:49/131 - (37%) Gaps:49/131 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 SMEPAFHRGDLLF---LTNYKEEPVRVGEIVVFK---------VEGRDIPIVHRVIK---LHEKE 111
            ||.|.|..||.|.   ::.|..:|. ..:||:||         ....|:.|...|.|   |.|..
plant   161 SMYPTFDVGDRLVAEKVSYYFRKPC-ANDIVIFKSPPVLQEVGYTDADVFIKRIVAKEGDLVEVH 224

  Fly   112 DGSV---------KFLTK-------------------GDN-NNVDDRGLYAPNQLWLTKKDIVGR 147
            :|.:         ||:.:                   ||| ||..|..::.|    |..|:|:||
plant   225 NGKLMVNGVARNEKFILEPPGYEMTPIRVPENSVFVMGDNRNNSYDSHVWGP----LPLKNIIGR 285

  Fly   148 A 148
            :
plant   286 S 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twrNP_649676.1 Peptidase_S24_S26 28..181 CDD:447902 34/131 (26%)
PLSP1NP_189102.3 Peptidase_S26 136..291 CDD:431321 34/131 (26%)

Return to query results.
Submit another query.