DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twr and TPP

DIOPT Version :10

Sequence 1:NP_649676.1 Gene:twr / 40815 FlyBaseID:FBgn0262801 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_180603.2 Gene:TPP / 817595 AraportID:AT2G30440 Length:340 Species:Arabidopsis thaliana


Alignment Length:136 Identity:30/136 - (22%)
Similarity:45/136 - (33%) Gaps:52/136 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 SGSMEPAFHRGDLLFL--TNYKEEPVRVGEIVVFKV------------EGRDIPIVHRVIKLH-- 108
            |.||.|...:||.:..  .:|......|.:||:||.            ...|: .:.|::...  
plant   182 STSMYPTLDKGDRVMAEKVSYFFRKPEVSDIVIFKAPPILLEYPEYGYSSNDV-FIKRIVASEGD 245

  Fly   109 --EKEDGSV----------------------KFLTK------GDNNNVD-DRGLYAPNQLWLTKK 142
              |..||.:                      .|:.|      |||.|.. |...:.|    |..:
plant   246 WVEVRDGKLFVNDIVQEEDFVLEPMSYEMEPMFVPKGYVFVLGDNRNKSFDSHNWGP----LPIE 306

  Fly   143 DIVGRA 148
            :||||:
plant   307 NIVGRS 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twrNP_649676.1 Peptidase_S24_S26 28..181 CDD:447902 30/136 (22%)
TPPNP_180603.2 Peptidase_S26 157..317 CDD:431321 30/136 (22%)

Return to query results.
Submit another query.