DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twr and immp1l

DIOPT Version :9

Sequence 1:NP_649676.1 Gene:twr / 40815 FlyBaseID:FBgn0262801 Length:185 Species:Drosophila melanogaster
Sequence 2:XP_001335263.1 Gene:immp1l / 795154 ZFINID:ZDB-GENE-070522-4 Length:189 Species:Danio rerio


Alignment Length:181 Identity:39/181 - (21%)
Similarity:68/181 - (37%) Gaps:33/181 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KRQSLYQVLSFAMIVSSALMIWKGLMVVTGS------------------ESPIVVVLSGSMEPAF 67
            |..:..:..|..:||..::.:::|..|.|.|                  ....|.....||||..
Zfish     6 KHHACNEHYSELLIVIKSVRMFRGFFVKTISFVGYTVQYGCIAHCAFEYVGEFVSCSGPSMEPTI 70

  Fly    68 HRGDLLFLTNYKEEPVRV--GEIVVFKVEGR-DIPIVHRVIKLHEKEDGSVKFLTKGDNNNVDDR 129
            ...|::|.........|:  |:|::.|.... .:.|..|||.|    :|. |..|.|. :::...
Zfish    71 TNHDVVFSERISRHLYRIQKGDIIIAKSPSNPKMNICKRVIGL----EGD-KVCTSGP-SDIFKT 129

  Fly   130 GLYAP-NQLWL----TKKDIVGRARGFLPYVGII-TIFMNEYPKVKWAILS 174
            ..|.| ..:||    .:.....|:.|.:||..|. .:.:..:|...:.:|:
Zfish   130 HTYVPRGHVWLEGDNLRNSTDSRSYGPIPYALIRGRVCLKLWPPQSFGVLA 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twrNP_649676.1 Peptidase_S24_S26 28..181 CDD:415851 38/174 (22%)
immp1lXP_001335263.1 sigpep_I_bact 54..172 CDD:274044 29/123 (24%)
S26_SPase_I 57..166 CDD:119398 29/114 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.