DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twr and Immp1l

DIOPT Version :9

Sequence 1:NP_649676.1 Gene:twr / 40815 FlyBaseID:FBgn0262801 Length:185 Species:Drosophila melanogaster
Sequence 2:XP_001076990.3 Gene:Immp1l / 691145 RGDID:1587441 Length:166 Species:Rattus norvegicus


Alignment Length:121 Identity:35/121 - (28%)
Similarity:50/121 - (41%) Gaps:16/121 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 VVVLSG-SMEPAFHRGDLLFLTNYKEE--PVRVGEIVVFK-VEGRDIPIVHRVIKLHEKEDGSVK 116
            ||:.|| ||||.....|::|..|....  .::.|:||:.| .......|..|||.|    :|. |
  Rat    33 VVMCSGPSMEPTIQNSDIVFAENLSRHFYGIQRGDIVIAKSPSDPKSSICKRVIGL----EGD-K 92

  Fly   117 FLTKGDNNNVDDRGLYAPNQLWLTKKDIV----GRARGFLPYVGII--TIFMNEYP 166
            .|.....:....|.......:||...::.    .|..|.:|| |:|  .||...:|
  Rat    93 ILADNPPDIFKSRNYVPTGHVWLEGDNLENSTDSRCYGPVPY-GLIRGRIFFKIWP 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twrNP_649676.1 Peptidase_S24_S26 28..181 CDD:415851 35/121 (29%)
Immp1lXP_001076990.3 sigpep_I_bact 29..149 CDD:274044 35/121 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.