DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twr and Sec11a

DIOPT Version :9

Sequence 1:NP_649676.1 Gene:twr / 40815 FlyBaseID:FBgn0262801 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_064335.1 Gene:Sec11a / 56529 MGIID:1929464 Length:179 Species:Mus musculus


Alignment Length:180 Identity:136/180 - (75%)
Similarity:158/180 - (87%) Gaps:1/180 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MLQIDEMLGDFNRMNKRQSLYQVLSFAMIVSSALMIWKGLMVVTGSESPIVVVLSGSMEPAFHRG 70
            ||.:| .|.|..||||||..||||:|.|||||||||||||||:||||||||||||||||||||||
Mouse     1 MLSLD-FLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRG 64

  Fly    71 DLLFLTNYKEEPVRVGEIVVFKVEGRDIPIVHRVIKLHEKEDGSVKFLTKGDNNNVDDRGLYAPN 135
            |||||||..|:|:||||||||::|||:|||||||:|:|||:||.:|||||||||.|||||||...
Mouse    65 DLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQDGHIKFLTKGDNNAVDDRGLYKQG 129

  Fly   136 QLWLTKKDIVGRARGFLPYVGIITIFMNEYPKVKWAILSILAIFVLLHRE 185
            |.||.|||:|||||||:||:||:||.||:|||.|:|:|.:|.:|||:|||
Mouse   130 QHWLEKKDVVGRARGFVPYIGIVTILMNDYPKFKYAVLFLLGLFVLVHRE 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twrNP_649676.1 Peptidase_S24_S26 28..181 CDD:415851 118/152 (78%)
Sec11aNP_064335.1 Peptidase_S24_S26 38..>150 CDD:415851 90/111 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834932
Domainoid 1 1.000 119 1.000 Domainoid score I5787
eggNOG 1 0.900 - - E1_COG0681
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 284 1.000 Inparanoid score I2842
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54172
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001985
OrthoInspector 1 1.000 - - otm43914
orthoMCL 1 0.900 - - OOG6_100807
Panther 1 1.100 - - LDO PTHR10806
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2283
SonicParanoid 1 1.000 - - X1299
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.830

Return to query results.
Submit another query.