DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twr and Sec11a

DIOPT Version :10

Sequence 1:NP_649676.1 Gene:twr / 40815 FlyBaseID:FBgn0262801 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001405485.1 Gene:Sec11a / 56529 MGIID:1929464 Length:190 Species:Mus musculus


Alignment Length:191 Identity:135/191 - (70%)
Similarity:157/191 - (82%) Gaps:12/191 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MLQIDEMLGDFNRMNKRQSLYQVLSFAMIVSSALMIWKGLMVVTGSESPIVVVLSGSMEPAFHRG 70
            ||.:| .|.|..||||||..||||:|.|||||||||||||||:||||||||||||||||||||||
Mouse     1 MLSLD-FLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRG 64

  Fly    71 DLLFLTNYKEEPVRVGEIVVFKVEGRDIPIVHRVIKLHEK-----------EDGSVKFLTKGDNN 124
            |||||||..|:|:||||||||::|||:|||||||:|:||.           :||.:|||||||||
Mouse    65 DLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHENSAGERKHSICWQDGHIKFLTKGDNN 129

  Fly   125 NVDDRGLYAPNQLWLTKKDIVGRARGFLPYVGIITIFMNEYPKVKWAILSILAIFVLLHRE 185
            .|||||||...|.||.|||:|||||||:||:||:||.||:|||.|:|:|.:|.:|||:|||
Mouse   130 AVDDRGLYKQGQHWLEKKDVVGRARGFVPYIGIVTILMNDYPKFKYAVLFLLGLFVLVHRE 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twrNP_649676.1 Peptidase_S24_S26 28..181 CDD:447902 117/163 (72%)
Sec11aNP_001405485.1 Peptidase_S24_S26 38..>161 CDD:447902 89/122 (73%)

Return to query results.
Submit another query.