DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twr and immp2l

DIOPT Version :10

Sequence 1:NP_649676.1 Gene:twr / 40815 FlyBaseID:FBgn0262801 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001003755.1 Gene:immp2l / 445299 ZFINID:ZDB-GENE-040808-9 Length:183 Species:Danio rerio


Alignment Length:127 Identity:28/127 - (22%)
Similarity:55/127 - (43%) Gaps:28/127 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GSESPIVVVLSGSMEPAFH--RGDLLFLTNYKEEPVRVGEIVVFKVEG---RDIPIVHRVIKLHE 109
            |..||.||:|:......:|  |||::.:.:.|....::.:.|: .:||   :.:...:|.:::  
Zfish    51 GESSPDVVLLNRWSVRNYHVQRGDIVSVLSPKNPQQKIIKRVI-GIEGDFIKTLGYKNRYVRV-- 112

  Fly   110 KEDGSVKFLTKGDNNNVD-DRGLYAPNQLWLTKKDIVGRARGFLPYVGIITIFMNEYPKVKW 170
             .||.:  ..:||::... |...:.|..|.|    :.|||...:            :|..:|
Zfish   113 -PDGHL--WIEGDHHGHSFDSNAFGPVSLGL----VHGRASHII------------WPPSRW 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twrNP_649676.1 Peptidase_S24_S26 28..181 CDD:447902 28/127 (22%)
immp2lNP_001003755.1 Peptidase_S26 8..150 CDD:431321 26/120 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..183
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.