DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twr and sec11a

DIOPT Version :9

Sequence 1:NP_649676.1 Gene:twr / 40815 FlyBaseID:FBgn0262801 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001002521.1 Gene:sec11a / 436794 ZFINID:ZDB-GENE-040718-227 Length:179 Species:Danio rerio


Alignment Length:180 Identity:136/180 - (75%)
Similarity:158/180 - (87%) Gaps:1/180 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MLQIDEMLGDFNRMNKRQSLYQVLSFAMIVSSALMIWKGLMVVTGSESPIVVVLSGSMEPAFHRG 70
            ||.:| .|.|..||||||..||||:|.||||||||||||||||||||||||||||||||||.|||
Zfish     1 MLSLD-FLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVVTGSESPIVVVLSGSMEPALHRG 64

  Fly    71 DLLFLTNYKEEPVRVGEIVVFKVEGRDIPIVHRVIKLHEKEDGSVKFLTKGDNNNVDDRGLYAPN 135
            |||||||..|:|:||||||||::|||:|||||||:|:||||:|.:|||||||||:|||||||...
Zfish    65 DLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKENGDIKFLTKGDNNSVDDRGLYKQG 129

  Fly   136 QLWLTKKDIVGRARGFLPYVGIITIFMNEYPKVKWAILSILAIFVLLHRE 185
            |.||.|||:|||||||:||:||:||.||:|||.|:|:|.:|.:|||:|||
Zfish   130 QHWLEKKDVVGRARGFVPYIGIVTILMNDYPKFKYAVLCLLGLFVLVHRE 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twrNP_649676.1 Peptidase_S24_S26 28..181 CDD:415851 118/152 (78%)
sec11aNP_001002521.1 Peptidase_S24_S26 38..>150 CDD:299172 90/111 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578004
Domainoid 1 1.000 121 1.000 Domainoid score I5655
eggNOG 1 0.900 - - E1_COG0681
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 285 1.000 Inparanoid score I2836
OMA 1 1.010 - - QHG54172
OrthoDB 1 1.010 - - D1486616at2759
OrthoFinder 1 1.000 - - FOG0001985
OrthoInspector 1 1.000 - - oto39651
orthoMCL 1 0.900 - - OOG6_100807
Panther 1 1.100 - - LDO PTHR10806
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2283
SonicParanoid 1 1.000 - - X1299
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.