DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twr and sec11a

DIOPT Version :9

Sequence 1:NP_649676.1 Gene:twr / 40815 FlyBaseID:FBgn0262801 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_989135.1 Gene:sec11a / 394740 XenbaseID:XB-GENE-943208 Length:179 Species:Xenopus tropicalis


Alignment Length:180 Identity:135/180 - (75%)
Similarity:158/180 - (87%) Gaps:1/180 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MLQIDEMLGDFNRMNKRQSLYQVLSFAMIVSSALMIWKGLMVVTGSESPIVVVLSGSMEPAFHRG 70
            ||.:| .|.|..||||||..||||:|.|||||||||||||||:||||||||||||||||||||||
 Frog     1 MLSMD-FLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRG 64

  Fly    71 DLLFLTNYKEEPVRVGEIVVFKVEGRDIPIVHRVIKLHEKEDGSVKFLTKGDNNNVDDRGLYAPN 135
            |||||||..::|:||||||||::|||:|||||||:|:||||:|.:|||||||||.|||||||...
 Frog    65 DLLFLTNRVDDPIRVGEIVVFRIEGREIPIVHRVLKIHEKENGDIKFLTKGDNNAVDDRGLYKQG 129

  Fly   136 QLWLTKKDIVGRARGFLPYVGIITIFMNEYPKVKWAILSILAIFVLLHRE 185
            |.||.|||:|||||||:||:||:||.||:|||.|:|:|.:|.:|||:|||
 Frog   130 QNWLEKKDVVGRARGFVPYIGIVTILMNDYPKFKYAVLFLLGLFVLVHRE 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twrNP_649676.1 Peptidase_S24_S26 28..181 CDD:415851 117/152 (77%)
sec11aNP_989135.1 Peptidase_S24_S26 38..>150 CDD:385677 89/111 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 119 1.000 Domainoid score I5740
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 282 1.000 Inparanoid score I2819
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1486616at2759
OrthoFinder 1 1.000 - - FOG0001985
OrthoInspector 1 1.000 - - oto104772
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2283
SonicParanoid 1 1.000 - - X1299
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.