DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twr and LOC3290502

DIOPT Version :10

Sequence 1:NP_649676.1 Gene:twr / 40815 FlyBaseID:FBgn0262801 Length:185 Species:Drosophila melanogaster
Sequence 2:XP_551123.2 Gene:LOC3290502 / 3290502 VectorBaseID:AGAMI1_002904 Length:247 Species:Anopheles gambiae


Alignment Length:55 Identity:14/55 - (25%)
Similarity:25/55 - (45%) Gaps:7/55 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 VVVLSGSMEPAFHRGDLLFLTNYKEEPVRV--GEIVVFKVEGRDIPIVH---RVI 105
            ||.:..||||.....::|..........::  |:|::.|...:  |:.|   |:|
Mosquito    33 VVCVGPSMEPTLMTNNVLITDRITPRLAKLQRGDIIITKSPTK--PVQHVCKRII 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twrNP_649676.1 Peptidase_S24_S26 28..181 CDD:447902 14/55 (25%)
LOC3290502XP_551123.2 sigpep_I_bact 37..241 CDD:274044 12/51 (24%)

Return to query results.
Submit another query.