DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twr and AT1G23465

DIOPT Version :10

Sequence 1:NP_649676.1 Gene:twr / 40815 FlyBaseID:FBgn0262801 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001319068.1 Gene:AT1G23465 / 2745760 AraportID:AT1G23465 Length:169 Species:Arabidopsis thaliana


Alignment Length:110 Identity:30/110 - (27%)
Similarity:43/110 - (39%) Gaps:36/110 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 SMEPAFH-RGDLLF---LTNYKEEPVRVGEIVVFK---------------VEGRDIPIVHRVIKL 107
            ||.|..| .|::|.   ::...::|.| |:|||.:               |||..|..|...:|.
plant    47 SMIPTLHPSGNMLLAERISKRYQKPSR-GDIVVIRSPENPNKTPIKRVVGVEGDCISFVIDPVKS 110

  Fly   108 HEKE-----DGSVKFLTKGD--NNNVDDR-------GLYAPNQLW 138
            .|.:     .|.|  ..:||  :|:.|.|       ||.....||
plant   111 DESQTIVVPKGHV--FVQGDYTHNSRDSRNFGPVPYGLIQGRVLW 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twrNP_649676.1 Peptidase_S24_S26 28..181 CDD:447902 30/110 (27%)
AT1G23465NP_001319068.1 sigpep_I_bact 45..158 CDD:274044 30/110 (27%)

Return to query results.
Submit another query.