DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twr and SEC11A

DIOPT Version :9

Sequence 1:NP_649676.1 Gene:twr / 40815 FlyBaseID:FBgn0262801 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001258851.1 Gene:SEC11A / 23478 HGNCID:17718 Length:185 Species:Homo sapiens


Alignment Length:145 Identity:113/145 - (77%)
Similarity:127/145 - (87%) Gaps:1/145 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MLQIDEMLGDFNRMNKRQSLYQVLSFAMIVSSALMIWKGLMVVTGSESPIVVVLSGSMEPAFHRG 70
            ||.:| .|.|..||||||..||||:|.|||||||||||||||:||||||||||||||||||||||
Human     1 MLSLD-FLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRG 64

  Fly    71 DLLFLTNYKEEPVRVGEIVVFKVEGRDIPIVHRVIKLHEKEDGSVKFLTKGDNNNVDDRGLYAPN 135
            |||||||..|:|:||||||||::|||:|||||||:|:|||::|.:|||||||||.|||||||...
Human    65 DLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQNGHIKFLTKGDNNAVDDRGLYKQG 129

  Fly   136 QLWLTKKDIVGRARG 150
            |.||.|||:||||||
Human   130 QHWLEKKDVVGRARG 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twrNP_649676.1 Peptidase_S24_S26 28..181 CDD:415851 100/123 (81%)
SEC11ANP_001258851.1 Peptidase_S24_S26 38..>122 CDD:299172 68/83 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144824
Domainoid 1 1.000 118 1.000 Domainoid score I5847
eggNOG 1 0.900 - - E1_COG0681
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 284 1.000 Inparanoid score I2867
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54172
OrthoDB 1 1.010 - - D1486616at2759
OrthoFinder 1 1.000 - - FOG0001985
OrthoInspector 1 1.000 - - otm41864
orthoMCL 1 0.900 - - OOG6_100807
Panther 1 1.100 - - O PTHR10806
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2283
SonicParanoid 1 1.000 - - X1299
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.