DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twr and IMMP1L

DIOPT Version :9

Sequence 1:NP_649676.1 Gene:twr / 40815 FlyBaseID:FBgn0262801 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001291203.1 Gene:IMMP1L / 196294 HGNCID:26317 Length:166 Species:Homo sapiens


Alignment Length:123 Identity:36/123 - (29%)
Similarity:52/123 - (42%) Gaps:20/123 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 VVVLSG-SMEPAFHRGDLLFLTNYKEE--PVRVGEIVVFKVEGRDIP---IVHRVIKLHEKEDGS 114
            ||:.|| ||||.....|::|..|....  .::.|:||:.|  ....|   |..|||.|    :|.
Human    33 VVMCSGPSMEPTIQNSDIVFAENLSRHFYGIQRGDIVIAK--SPSDPKSNICKRVIGL----EGD 91

  Fly   115 VKFLTKGDNNNVDDRGLYAPNQLWLTKKDIV----GRARGFLPYVGII--TIFMNEYP 166
             |.||...::............:||...::.    .|..|.:|| |:|  .||...:|
Human    92 -KILTTSPSDFFKSHSYVPMGHVWLEGDNLQNSTDSRCYGPIPY-GLIRGRIFFKIWP 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twrNP_649676.1 Peptidase_S24_S26 28..181 CDD:415851 36/123 (29%)
IMMP1LNP_001291203.1 S26_SPase_I 33..141 CDD:119398 33/115 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.