DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twr and sec-11

DIOPT Version :9

Sequence 1:NP_649676.1 Gene:twr / 40815 FlyBaseID:FBgn0262801 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_491092.1 Gene:sec-11 / 171876 WormBaseID:WBGene00021844 Length:183 Species:Caenorhabditis elegans


Alignment Length:174 Identity:122/174 - (70%)
Similarity:149/174 - (85%) Gaps:0/174 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MLGDFNRMNKRQSLYQVLSFAMIVSSALMIWKGLMVVTGSESPIVVVLSGSMEPAFHRGDLLFLT 76
            |..:..:||.||..||.|:|||:||||||||||:||:|||:||:||||||||||||:|||||.||
 Worm     9 MFSEIRQMNIRQLFYQCLNFAMVVSSALMIWKGMMVITGSDSPVVVVLSGSMEPAFYRGDLLLLT 73

  Fly    77 NYKEEPVRVGEIVVFKVEGRDIPIVHRVIKLHEKEDGSVKFLTKGDNNNVDDRGLYAPNQLWLTK 141
            |..|:|||||:|.|||||||:|||||||||:|||...:.|.|||||||.|||||||||.||||::
 Worm    74 NDLEDPVRVGDITVFKVEGREIPIVHRVIKVHEKSADNTKILTKGDNNQVDDRGLYAPGQLWLSR 138

  Fly   142 KDIVGRARGFLPYVGIITIFMNEYPKVKWAILSILAIFVLLHRE 185
            .|:|||.:|.|||||::||.||:|||:|:|:|:.|.:|||||:|
 Worm   139 TDVVGRTKGLLPYVGMVTIIMNDYPKLKYAVLAFLGLFVLLHKE 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twrNP_649676.1 Peptidase_S24_S26 28..181 CDD:415851 110/152 (72%)
sec-11NP_491092.1 Peptidase_S24_S26 41..178 CDD:299172 97/136 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158385
Domainoid 1 1.000 114 1.000 Domainoid score I3827
eggNOG 1 0.900 - - E1_COG0681
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8624
Inparanoid 1 1.050 262 1.000 Inparanoid score I1903
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54172
OrthoDB 1 1.010 - - D1486616at2759
OrthoFinder 1 1.000 - - FOG0001985
OrthoInspector 1 1.000 - - oto20587
orthoMCL 1 0.900 - - OOG6_100807
Panther 1 1.100 - - LDO PTHR10806
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2283
SonicParanoid 1 1.000 - - X1299
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.