DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1307 and PTH2

DIOPT Version :9

Sequence 1:NP_001287202.1 Gene:CG1307 / 40814 FlyBaseID:FBgn0026566 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_009496.2 Gene:PTH2 / 852223 SGDID:S000000153 Length:208 Species:Saccharomyces cerevisiae


Alignment Length:187 Identity:66/187 - (35%)
Similarity:89/187 - (47%) Gaps:20/187 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LSFFVGYRYALKRGDA--KDSVT--------EGAA-TPFSQESSVSSGSEASVSDKGYGGLND-- 70
            :||.|||:.......:  |.|.|        ||.. ....:|.|.|........|.....|||  
Yeast    21 ISFAVGYQLGTSNASSTKKSSATLLRSKEMKEGKLHNDTDEEESESEDESDEDEDIESTSLNDIP 85

  Fly    71 -NFKMVLVVRNDLKMGKGKIAAQCGHGAVGAYQRAVVR------TPRLLRSWENCGCAKIAVRVE 128
             ..:|.||:|.||.|.||||||||.|.|:..::.....      .|.:.:.|.|.|.|||.::..
Yeast    86 GEVRMALVIRQDLGMTKGKIAAQCCHAALSCFRHIATNPARASYNPIMTQRWLNAGQAKITLKCP 150

  Fly   129 SEAELMAIKKEAERQQLNTCLIRDAGRTQIEANSKTVLAVGPAAAADIDRVTGHLKL 185
            .:..:..:..:|....:|..:|.|||||||.|.|.|||.:|||..|.:|::||.|||
Yeast   151 DKFTMDELYAKAISLGVNAAVIHDAGRTQIAAGSATVLGLGPAPKAVLDQITGDLKL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1307NP_001287202.1 PTH2 72..186 CDD:239108 49/120 (41%)
PTH2NP_009496.2 arch_pth2 88..208 CDD:161803 49/120 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341598
Domainoid 1 1.000 99 1.000 Domainoid score I1575
eggNOG 1 0.900 - - E1_COG1990
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1461
Isobase 1 0.950 - 0 Normalized mean entropy S1358
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001905
OrthoInspector 1 1.000 - - otm46529
orthoMCL 1 0.900 - - OOG6_100991
Panther 1 1.100 - - LDO PTHR12649
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1028
SonicParanoid 1 1.000 - - X1849
TreeFam 1 0.960 - -
1413.730

Return to query results.
Submit another query.