DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1307 and AT3G03010

DIOPT Version :9

Sequence 1:NP_001287202.1 Gene:CG1307 / 40814 FlyBaseID:FBgn0026566 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001030627.1 Gene:AT3G03010 / 821157 AraportID:AT3G03010 Length:179 Species:Arabidopsis thaliana


Alignment Length:149 Identity:65/149 - (43%)
Similarity:93/149 - (62%) Gaps:11/149 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SQESSVSSGSEASVSDKG--------YGGLNDNFKMVLVVRNDLKMGKGKIAAQCGHGAVGAYQR 103
            |:..::.:||..:...|.        ......|||||||||||||||||||||||.|..:|.|::
plant    33 SKSVAIDAGSSGNKKTKSKEPLEIEKLADFRKNFKMVLVVRNDLKMGKGKIAAQCSHATLGLYKK 97

  Fly   104 AVVRTPRLLRSWENCGCAKIAVRVESEAELMAIKKEAERQQLNTCLIRDAGRTQIEANSKTVLAV 168
            .:.|.|:.|..||.|...|:.|::|||.|::.:::.|:..:|.|.:..|||:|||..||:||:|:
plant    98 LLQRAPKALNRWEYCAQPKVVVKIESEEEMLVLQERAKTLKLPTHITIDAGKTQIAPNSRTVMAI 162

  Fly   169 -GPAAAADIDRVTGHLKLL 186
             ||  ..::|.|||.|||:
plant   163 LGP--VDNVDEVTGGLKLM 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1307NP_001287202.1 PTH2 72..186 CDD:239108 59/114 (52%)
AT3G03010NP_001030627.1 PTH2 66..178 CDD:239108 58/113 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 118 1.000 Domainoid score I1932
eggNOG 1 0.900 - - E1_COG1990
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5330
Inparanoid 1 1.050 123 1.000 Inparanoid score I1955
OMA 1 1.010 - - QHG62222
OrthoDB 1 1.010 - - D1564104at2759
OrthoFinder 1 1.000 - - FOG0001905
OrthoInspector 1 1.000 - - otm2494
orthoMCL 1 0.900 - - OOG6_100991
Panther 1 1.100 - - O PTHR12649
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1849
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.