DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1307 and ptrh2

DIOPT Version :9

Sequence 1:NP_001287202.1 Gene:CG1307 / 40814 FlyBaseID:FBgn0026566 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001018371.2 Gene:ptrh2 / 791795 ZFINID:ZDB-GENE-050522-163 Length:176 Species:Danio rerio


Alignment Length:187 Identity:81/187 - (43%)
Similarity:104/187 - (55%) Gaps:19/187 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DKLLDPTQIINGLAVM----LSFFVGYRYALKRGDAKDSVTEGAATPFSQESSVSSGSEASVSDK 63
            |.|..|.    ||.|:    ....||:..:.:.|.:..|:.....      :|.|:|||.||.  
Zfish     4 DSLYGPF----GLGVLAGLGCGLCVGWHLSGRFGRSSRSMMTALG------NSASNGSETSVM-- 56

  Fly    64 GYGGLNDNFKMVLVVRNDLKMGKGKIAAQCGHGAVGAYQRAVVRTPRLLRSWENCGCAKIAVRVE 128
               |.:..|||:||||.||||||||:||||.|.||.||::...|.|.||:.|||.|..|:.|:..
Zfish    57 ---GESGEFKMILVVRTDLKMGKGKVAAQCSHAAVSAYKQVQRRNPELLKQWENSGQPKVVVKAP 118

  Fly   129 SEAELMAIKKEAERQQLNTCLIRDAGRTQIEANSKTVLAVGPAAAADIDRVTGHLKL 185
            .|..|:.:...|:...|...||:|||||||...|:|||.:||..|..||:|||||||
Zfish   119 DEDCLLDLLAHAKEVGLPVSLIQDAGRTQIAPGSRTVLGIGPGQADLIDKVTGHLKL 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1307NP_001287202.1 PTH2 72..186 CDD:239108 63/114 (55%)
ptrh2NP_001018371.2 PTH2 62..176 CDD:239108 63/114 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574574
Domainoid 1 1.000 122 1.000 Domainoid score I5628
eggNOG 1 0.900 - - E1_COG1990
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5330
Inparanoid 1 1.050 131 1.000 Inparanoid score I4605
OMA 1 1.010 - - QHG62222
OrthoDB 1 1.010 - - D1564104at2759
OrthoFinder 1 1.000 - - FOG0001905
OrthoInspector 1 1.000 - - oto39444
orthoMCL 1 0.900 - - OOG6_100991
Panther 1 1.100 - - LDO PTHR12649
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1028
SonicParanoid 1 1.000 - - X1849
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.