DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1307 and si:dkey-19e4.5

DIOPT Version :9

Sequence 1:NP_001287202.1 Gene:CG1307 / 40814 FlyBaseID:FBgn0026566 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001313497.1 Gene:si:dkey-19e4.5 / 570260 ZFINID:ZDB-GENE-030131-1852 Length:189 Species:Danio rerio


Alignment Length:153 Identity:56/153 - (36%)
Similarity:78/153 - (50%) Gaps:16/153 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SVTEGAATPFSQESSVSSGSEASVSDKGYGGLNDNFKMVLVVRNDLKMGKGKIAAQCGHGAVGAY 101
            |..|.|...|::..:...|.|..:           ||||.||..:|.||.||:|||.||.|||.|
Zfish    50 SAEEAAMYYFNKLENEEEGDEDLM-----------FKMVFVVNMELSMGVGKVAAQVGHAAVGLY 103

  Fly   102 QRAVVRTP--RLLRSWENCGCAKIAVRVESEAELMAIKKEAERQQLNTCLIRDAGRTQIEANSKT 164
            |....:..  .:...|::.|..||.::..:.|.|:.::..|....|.|.|::|||.||:|..|.|
Zfish   104 QALQEKNSWREMAWKWDHAGAKKIVLQGTNMAHLLELQALAMSLSLPTKLVQDAGLTQVEPGSCT 168

  Fly   165 VLA-VGPAAAADIDRVTGHLKLL 186
            ||| :|....  ::.|||.||||
Zfish   169 VLAIIGEEEM--VNNVTGSLKLL 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1307NP_001287202.1 PTH2 72..186 CDD:239108 48/116 (41%)
si:dkey-19e4.5NP_001313497.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1990
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564104at2759
OrthoFinder 1 1.000 - - FOG0001905
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1028
SonicParanoid 1 1.000 - - X1849
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.