DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1307 and ptrh2

DIOPT Version :9

Sequence 1:NP_001287202.1 Gene:CG1307 / 40814 FlyBaseID:FBgn0026566 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001016657.1 Gene:ptrh2 / 549411 XenbaseID:XB-GENE-5849009 Length:171 Species:Xenopus tropicalis


Alignment Length:140 Identity:71/140 - (50%)
Similarity:89/140 - (63%) Gaps:5/140 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 FSQESSVSSGSEASVSDKGYGGLNDNFKMVLVVRNDLKMGKGKIAAQCGHGAVGAYQRAVVRTPR 110
            ||..::...|:|||..     |....|||||||||||||||||:||||.|.||.||::.:.|.|.
 Frog    36 FSTLATNEVGTEASTM-----GETGEFKMVLVVRNDLKMGKGKVAAQCSHAAVSAYKQLLKRNPE 95

  Fly   111 LLRSWENCGCAKIAVRVESEAELMAIKKEAERQQLNTCLIRDAGRTQIEANSKTVLAVGPAAAAD 175
            ||:.||.||..|:.::...|...:.:...|::..|...||:|||||||...|:|||.|||..|..
 Frog    96 LLKQWEYCGQPKVVLKAPDEDSFVELLSHAKQLGLTVSLIQDAGRTQIAPGSRTVLGVGPGPADL 160

  Fly   176 IDRVTGHLKL 185
            ||:|||||||
 Frog   161 IDKVTGHLKL 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1307NP_001287202.1 PTH2 72..186 CDD:239108 64/114 (56%)
ptrh2NP_001016657.1 PTH2 57..171 CDD:239108 64/114 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 128 1.000 Domainoid score I5272
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H5330
Inparanoid 1 1.050 133 1.000 Inparanoid score I4488
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564104at2759
OrthoFinder 1 1.000 - - FOG0001905
OrthoInspector 1 1.000 - - oto102420
Panther 1 1.100 - - LDO PTHR12649
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1849
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.