DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1307 and PTRH2

DIOPT Version :9

Sequence 1:NP_001287202.1 Gene:CG1307 / 40814 FlyBaseID:FBgn0026566 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001015509.1 Gene:PTRH2 / 51651 HGNCID:24265 Length:180 Species:Homo sapiens


Alignment Length:141 Identity:70/141 - (49%)
Similarity:90/141 - (63%) Gaps:3/141 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PFSQESSVSSGSEASVSDKGYGGLNDNFKMVLVVRNDLKMGKGKIAAQCGHGAVGAYQRAVVRTP 109
            |.|:.|...:.:|:..|..|..|   .:||:|||||||||||||:||||.|.||.||::...|.|
Human    42 PKSKTSKTHTDTESEASILGDSG---EYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNP 103

  Fly   110 RLLRSWENCGCAKIAVRVESEAELMAIKKEAERQQLNTCLIRDAGRTQIEANSKTVLAVGPAAAA 174
            .:|:.||.||..|:.|:...|..|:|:...|:...|...||:|||||||...|:|||.:||..|.
Human   104 EMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPAD 168

  Fly   175 DIDRVTGHLKL 185
            .||:|||||||
Human   169 LIDKVTGHLKL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1307NP_001287202.1 PTH2 72..186 CDD:239108 63/114 (55%)
PTRH2NP_001015509.1 PTH2 66..180 CDD:239108 63/114 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141587
Domainoid 1 1.000 128 1.000 Domainoid score I5334
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5330
Inparanoid 1 1.050 133 1.000 Inparanoid score I4615
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62222
OrthoDB 1 1.010 - - D1564104at2759
OrthoFinder 1 1.000 - - FOG0001905
OrthoInspector 1 1.000 - - oto88547
orthoMCL 1 0.900 - - OOG6_100991
Panther 1 1.100 - - LDO PTHR12649
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1028
SonicParanoid 1 1.000 - - X1849
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.900

Return to query results.
Submit another query.