DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1307 and CG17327

DIOPT Version :9

Sequence 1:NP_001287202.1 Gene:CG1307 / 40814 FlyBaseID:FBgn0026566 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001262519.1 Gene:CG17327 / 41598 FlyBaseID:FBgn0038107 Length:139 Species:Drosophila melanogaster


Alignment Length:117 Identity:55/117 - (47%)
Similarity:78/117 - (66%) Gaps:3/117 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 KMVLVVRNDLKMGKGKIAAQCGHGAVGAYQRAVVRTP---RLLRSWENCGCAKIAVRVESEAELM 134
            |:.||||.||||.|||.||||.|.||..||.:|..|.   .:|:.|...|..||.:||::..:|.
  Fly    23 KLALVVRTDLKMSKGKTAAQCAHAAVMCYQSSVQGTKLQNAILQRWCRLGQPKIVLRVDNFEQLN 87

  Fly   135 AIKKEAERQQLNTCLIRDAGRTQIEANSKTVLAVGPAAAADIDRVTGHLKLL 186
            :::::|:...:...|:|||||||:|:.:.|||.:|||.|.|:|::..|||||
  Fly    88 SLERQAQESNVVAALVRDAGRTQLESGTATVLGLGPAPAEDLDKLVAHLKLL 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1307NP_001287202.1 PTH2 72..186 CDD:239108 53/115 (46%)
CG17327NP_001262519.1 PTH2 23..139 CDD:239108 53/115 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439089
Domainoid 1 1.000 81 1.000 Domainoid score I5476
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1461
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62222
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001905
OrthoInspector 1 1.000 - - otm14583
orthoMCL 1 0.900 - - OOG6_100991
Panther 1 1.100 - - P PTHR12649
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1028
SonicParanoid 00.000 Not matched by this tool.
109.930

Return to query results.
Submit another query.