DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1307 and Ptrh2

DIOPT Version :9

Sequence 1:NP_001287202.1 Gene:CG1307 / 40814 FlyBaseID:FBgn0026566 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001013882.1 Gene:Ptrh2 / 287593 RGDID:1306819 Length:181 Species:Rattus norvegicus


Alignment Length:187 Identity:77/187 - (41%)
Similarity:100/187 - (53%) Gaps:26/187 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 MLSFFVGYRYALKRGDAKDSVTEGAATP-------------FSQESS------VSSGSEASVSDK 63
            |||..:...|.:..|..  |:..|.|..             |.|.|:      ...|:|||:.  
  Rat     1 MLSKLLTMEYLVHPGTL--SLAAGVACGMCLGWGLRSHLGIFPQNSTSETNRDTEMGTEASIL-- 61

  Fly    64 GYGGLNDNFKMVLVVRNDLKMGKGKIAAQCGHGAVGAYQRAVVRTPRLLRSWENCGCAKIAVRVE 128
               |.:..:||:||||.||||||||:||||.|.||.||::...|.|::|:.||.||..|:.|:..
  Rat    62 ---GESGEYKMILVVRTDLKMGKGKVAAQCSHAAVSAYKQIQRRNPQVLKEWEYCGQPKVVVKAP 123

  Fly   129 SEAELMAIKKEAERQQLNTCLIRDAGRTQIEANSKTVLAVGPAAAADIDRVTGHLKL 185
            .|..|:.:...|:...|...||:||||||||..|:|||.:||.....||.|||||||
  Rat   124 DEDSLIQLLTHAKALGLTVSLIQDAGRTQIEPGSRTVLGIGPGPVELIDEVTGHLKL 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1307NP_001287202.1 PTH2 72..186 CDD:239108 61/114 (54%)
Ptrh2NP_001013882.1 PTH2 67..181 CDD:239108 61/114 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335277
Domainoid 1 1.000 124 1.000 Domainoid score I5411
eggNOG 1 0.900 - - E1_COG1990
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5330
Inparanoid 1 1.050 128 1.000 Inparanoid score I4575
OMA 1 1.010 - - QHG62222
OrthoDB 1 1.010 - - D1564104at2759
OrthoFinder 1 1.000 - - FOG0001905
OrthoInspector 1 1.000 - - oto95683
orthoMCL 1 0.900 - - OOG6_100991
Panther 1 1.100 - - LDO PTHR12649
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1849
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.