DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1307 and C24G6.8

DIOPT Version :9

Sequence 1:NP_001287202.1 Gene:CG1307 / 40814 FlyBaseID:FBgn0026566 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001367534.1 Gene:C24G6.8 / 178937 WormBaseID:WBGene00016062 Length:316 Species:Caenorhabditis elegans


Alignment Length:198 Identity:72/198 - (36%)
Similarity:101/198 - (51%) Gaps:24/198 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DPTQIING-LAVMLSF-FVGYR--YALKRGDAKDSVTEGAA--------TPFSQESSVSSGSEAS 59
            :|.::.|. ||.:|.. |..|.  .||||.::. .|.:..|        :.|.::|| ||.:|| 
 Worm   125 EPNEVNNEYLAHLLDLGFDEYTAVLALKRTNSA-GVEQAVAWIVERSNESDFDEDSS-SSENEA- 186

  Fly    60 VSDKGYGGLND----NFKMVLVVRNDLKMGKGKIAAQCGHGAVGAYQRAV--VRTPRLLRSWENC 118
              |:..|.:..    ..|||||....||||.||||||.||..:|.|::|:  ......:.:|...
 Worm   187 --DEEMGAVQSVAGRTHKMVLVANMSLKMGTGKIAAQVGHATLGVYRQAMNSENGQNAIAAWTRH 249

  Fly   119 GCAKIAVRVESEAELMAIKKEAERQQLNTCLIRDAGRTQIEANSKTVLAVGPAAAADIDRVTGHL 183
            |..||.|:.:|..:||.:.|.|:.......|::|||.|||.|.|:|||.:. .....:|.|||.|
 Worm   250 GQVKIVVKGQSTEQLMDLCKVAKDAGCYYYLVQDAGYTQIPAGSRTVLGIF-GTVEQVDSVTGGL 313

  Fly   184 KLL 186
            |||
 Worm   314 KLL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1307NP_001287202.1 PTH2 72..186 CDD:239108 48/115 (42%)
C24G6.8NP_001367534.1 UBA_like_SF 128..171 CDD:419673 12/43 (28%)
PTH2 201..316 CDD:239108 48/115 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I5476
eggNOG 1 0.900 - - E1_COG1990
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1358
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001905
OrthoInspector 1 1.000 - - otm14583
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1028
SonicParanoid 1 1.000 - - X1849
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.