DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1307 and LOC100497652

DIOPT Version :9

Sequence 1:NP_001287202.1 Gene:CG1307 / 40814 FlyBaseID:FBgn0026566 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_002938434.1 Gene:LOC100497652 / 100497652 -ID:- Length:189 Species:Xenopus tropicalis


Alignment Length:116 Identity:50/116 - (43%)
Similarity:68/116 - (58%) Gaps:3/116 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 KMVLVVRNDLKMGKGKIAAQCGHGAVGAYQRAV--VRTPRLLRSWENCGCAKIAVRVESEAELMA 135
            |||.||..:|.||.||||||.||.|||.||..:  .:|..:...|:..|..|:.::..|.|.|:.
 Frog    74 KMVFVVNMELPMGVGKIAAQVGHAAVGLYQNLIKEPKTREMAYKWDEYGAKKVVLQGSSTAHLLE 138

  Fly   136 IKKEAERQQLNTCLIRDAGRTQIEANSKTVLAVGPAAAADIDRVTGHLKLL 186
            ::..|....|...|::|||||||.|.|.|||:: ......:::|||.||||
 Frog   139 LQALALSMNLPNYLVQDAGRTQIAAGSYTVLSI-MGEEESVNKVTGKLKLL 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1307NP_001287202.1 PTH2 72..186 CDD:239108 48/114 (42%)
LOC100497652XP_002938434.1 UBA_like_SF 20..57 CDD:389751
PTH2 73..188 CDD:239108 48/114 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564104at2759
OrthoFinder 1 1.000 - - FOG0001905
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1849
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.