DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sunz and CBL8

DIOPT Version :9

Sequence 1:NP_649673.1 Gene:sunz / 40811 FlyBaseID:FBgn0037462 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001319319.1 Gene:CBL8 / 842756 AraportID:AT1G64480 Length:214 Species:Arabidopsis thaliana


Alignment Length:215 Identity:51/215 - (23%)
Similarity:88/215 - (40%) Gaps:63/215 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 AASTEFSTNEVVSLLIVFYKYALNNRSRMMSTSQLYNLFLVSFGIFDVTIIDRISM-NITQDGRS 91
            |:.|.|:.||:.:|..:|.|         :||| :.|..|:....|.:.:....|| |:..|   
plant    26 ASETPFTVNEIEALHDLFKK---------LSTS-IINDGLIHKEEFLLALFRNGSMQNLFAD--- 77

  Fly    92 VSPEAWMRLFCVF---FNGSLQ------------------ERMKFAFEVYTSGGAVVLN----RE 131
                   |:|.:|   .||.::                  |:..|.|:::...|...:.    ::
plant    78 -------RVFYMFDRKRNGVIEFGEFVRSLSIFHPYTPEHEKSAFMFKLFDLHGTGFIEPHELKK 135

  Fly   132 VVGVAIEQFFTGDDDDEVNELRAD-MCEFIFGKFDTDKDGVIAFEEYAEIVQNQPGLLEFLGKIF 195
            :||..:     |:.|.|::|...: :.|....:.||:|||.|..||:.|:|...|.:|       
plant   136 MVGALL-----GETDLELSEESIEAIVEQTMLEVDTNKDGKIDEEEWKELVAKNPSIL------- 188

  Fly   196 PDDKDRSLVAYCHNIESMFP 215
               |:.:| .|...:...||
plant   189 ---KNMTL-PYLKEVTLAFP 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sunzNP_649673.1 EF-hand_7 113..181 CDD:290234 19/72 (26%)
CBL8NP_001319319.1 FRQ1 29..187 CDD:227455 44/182 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.