DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sunz and CBL10

DIOPT Version :9

Sequence 1:NP_649673.1 Gene:sunz / 40811 FlyBaseID:FBgn0037462 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_195026.1 Gene:CBL10 / 829437 AraportID:AT4G33000 Length:256 Species:Arabidopsis thaliana


Alignment Length:205 Identity:51/205 - (24%)
Similarity:82/205 - (40%) Gaps:35/205 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IKSFAASTEFSTNEVVSLLIVFYKYALN---------NRSRMMSTSQLY--NLFLVS-FGIFDVT 76
            ::..|..::||.|||.:|..:|.|.:.:         ...|:......|  ||||.. |.:||  
plant    64 LERLARESQFSVNEVEALYELFKKLSCSIIDDGLIHKEELRLALFQAPYGENLFLDRVFDLFD-- 126

  Fly    77 IIDRISMNITQDGRSVSPEAWMRLFCVFF-NGSLQERMKFAFEVYTSGGAVVLNREVVGVAIEQF 140
                     .:....:..|.::....||. ..|:||:..|||.:|.......:.||.|...:...
plant   127 ---------EKKNGVIEFEEFIHALSVFHPYASIQEKTDFAFRLYDLRQTGFIEREEVQQMVSAI 182

  Fly   141 FTGDDDDEVNELRADMCEFIFGKFDTDKDGVIAFEEYAEIVQNQPGLLEFLGKIFPDDKDRSLVA 205
            ....|....:||...:.:..|...|:||||.|:.:|:...|...|.||          |:.:| .
plant   183 LLESDMMLSDELLTMIIDKTFADADSDKDGKISKDEWNVYVHKHPSLL----------KNMTL-P 236

  Fly   206 YCHNIESMFP 215
            |..::.:.||
plant   237 YLKDVTTAFP 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sunzNP_649673.1 EF-hand_7 113..181 CDD:290234 18/67 (27%)
CBL10NP_195026.1 EF-hand_7 81..142 CDD:290234 13/71 (18%)
EFh 118..180 CDD:238008 17/72 (24%)
EF-hand_7 118..179 CDD:290234 17/71 (24%)
EFh 154..219 CDD:238008 17/64 (27%)
EF-hand_7 158..218 CDD:290234 16/59 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.