DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sunz and CBL3

DIOPT Version :9

Sequence 1:NP_649673.1 Gene:sunz / 40811 FlyBaseID:FBgn0037462 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001320073.1 Gene:CBL3 / 828764 AraportID:AT4G26570 Length:230 Species:Arabidopsis thaliana


Alignment Length:205 Identity:46/205 - (22%)
Similarity:83/205 - (40%) Gaps:39/205 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 AASTEFSTNEVVSLLIVFYKYA-------LNNRSR----MMSTSQLYNLFL-----VSFGIFDVT 76
            |..|.||.:|:.:|..:|.|.:       |.|:..    :..|::..:||.     ..|.:||  
plant    37 ARETVFSVSEIEALYELFKKISSAVIDDGLINKEEFQLALFKTNKKESLFADRYQSQVFDLFD-- 99

  Fly    77 IIDRISMNITQDGRSVSPEAWMRLFCVFF-NGSLQERMKFAFEVYTSGGAVVLNREVVGVAIEQF 140
                     |:....:..|.:.|...||. |..:::::.|:|::|.......:.|:.|...:...
plant   100 ---------TKHNGILGFEEFARALSVFHPNAPIEDKIDFSFQLYDLKQQGFIERQEVKQMVVAT 155

  Fly   141 FTGDDDDEVNELRADMCEFIFGKFDTDKDGVIAFEEYAEIVQNQPGLLEFLGKIFPDDKDRSLVA 205
            ......:..:|:...:.:..|.:.||..||.|..||:..:|...|.||          |:.:| .
plant   156 LAESGMNLSDEIIESIIDKTFEEADTKHDGRIDKEEWRTLVLRHPSLL----------KNMTL-Q 209

  Fly   206 YCHNIESMFP 215
            |..:|.:.||
plant   210 YLKDITTTFP 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sunzNP_649673.1 EF-hand_7 113..181 CDD:290234 14/67 (21%)
CBL3NP_001320073.1 EFh_PEF 40..202 CDD:330173 37/172 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.