DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sunz and CBL6

DIOPT Version :9

Sequence 1:NP_649673.1 Gene:sunz / 40811 FlyBaseID:FBgn0037462 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001328805.1 Gene:CBL6 / 827330 AraportID:AT4G16350 Length:226 Species:Arabidopsis thaliana


Alignment Length:198 Identity:42/198 - (21%)
Similarity:78/198 - (39%) Gaps:44/198 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KSFAASTEFSTNEVVSLLIVFYKYALN---------------NRSRMMSTSQLYNLF-LVSFGIF 73
            |..|..|.|:.||:.:|..:|...:.|               |.:|.:...::::|| ..:.||.
plant    32 KDVARGTVFTVNEIEALYELFKSISKNGLIDKEQFQLVLFKMNTTRSLFADRVFDLFDTKNTGIL 96

  Fly    74 DVTIIDRISMNITQDGRSVSPEAWMRLFCVFF-NGSLQERMKFAFEVYTSGGAVVLNREVVGVAI 137
            |.                   ||:.|...||. |...:::::|:|::|.......:.|:.|...:
plant    97 DF-------------------EAFARSLSVFHPNAKFEDKIEFSFKLYDLNQQGYIKRQEVKQMV 142

  Fly   138 EQFFTGDDDDEVNELRADMCEFIFGKFDTDKDGVIAFEEYAEIVQNQPGLLEFLG--------KI 194
            .:.......:..:.:...:.:..|.:.||..||.|..||:..:|...|.||:.:.        |.
plant   143 VRTLAESGMNLSDHVIESIIDKTFEEADTKLDGKIDKEEWRSLVLRHPSLLQNMSLQHLKDVTKT 207

  Fly   195 FPD 197
            ||:
plant   208 FPN 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sunzNP_649673.1 EF-hand_7 113..181 CDD:290234 13/67 (19%)
CBL6NP_001328805.1 FRQ1 38..192 CDD:227455 35/172 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.