DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sunz and EFCAB1

DIOPT Version :9

Sequence 1:NP_649673.1 Gene:sunz / 40811 FlyBaseID:FBgn0037462 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_078869.1 Gene:EFCAB1 / 79645 HGNCID:25678 Length:211 Species:Homo sapiens


Alignment Length:198 Identity:53/198 - (26%)
Similarity:89/198 - (44%) Gaps:11/198 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 MANNKFLTMYSTLIKSFAASTEFSTNEVVSLLIVFYKYALNNRSRM-----MSTSQLYNLFLVSF 70
            |...|...:..||.|:   ...|:..||..|:.:||. .:....|.     :..:...|:..|:|
Human     1 MNRKKLQKLTDTLTKN---CKHFNKFEVNCLIKLFYD-LVGGVERQGLVVGLDRNAFRNILHVTF 61

  Fly    71 GIFDVTIIDRISMNITQDGRS-VSPEAWMRLFCVFFNGSLQERMKFAFEVY-TSGGAVVLNREVV 133
            |:.|..|:||:.....:|... |:...|:....:|..|||:|:||:.|||: .:|...:...|:.
Human    62 GMTDDMIMDRVFRGFDKDNDGCVNVLEWIHGLSLFLRGSLEEKMKYCFEVFDLNGDGFISKEEMF 126

  Fly   134 GVAIEQFFTGDDDDEVNELRADMCEFIFGKFDTDKDGVIAFEEYAEIVQNQPGLLEFLGKIFPDD 198
            .:..........:::.:|...|:.|....|.|.|.||.::|.:|...|:.:..|||..|...||.
Human   127 HMLKNSLLKQPSEEDPDEGIKDLVEITLKKMDHDHDGKLSFADYELAVREETLLLEAFGPCLPDP 191

  Fly   199 KDR 201
            |.:
Human   192 KSQ 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sunzNP_649673.1 EF-hand_7 113..181 CDD:290234 17/68 (25%)
EFCAB1NP_078869.1 EFh_PEF <48..170 CDD:330173 32/121 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1331864at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.980

Return to query results.
Submit another query.