DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sunz and 1700109H08Rik

DIOPT Version :9

Sequence 1:NP_649673.1 Gene:sunz / 40811 FlyBaseID:FBgn0037462 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_084119.1 Gene:1700109H08Rik / 77036 MGIID:1924286 Length:210 Species:Mus musculus


Alignment Length:222 Identity:62/222 - (27%)
Similarity:101/222 - (45%) Gaps:22/222 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LDDMANNKFLTMYSTLIKSFAASTEFSTNEVVSLLIVFYKYALNNRSRMMSTSQLYNLFL-VSFG 71
            ::..|..|.:......:|||   .:|   ||..|:.:||........:|.:|....|.|. |...
Mouse     1 MEQRALKKMVESIRKTVKSF---KKF---EVECLIRLFYSLVGCPVGKMDNTGLDCNTFRGVLQN 59

  Fly    72 IFDVT---IIDRISMNITQDGRS-VSPEAWMRLFCVFFNGSLQERMKFAFEV-YTSGGAVVLNRE 131
            ||.:|   :::|:.....:||.. |:.|.|::...||..|:.:|:|:|.||| |.:|.|.:...:
Mouse    60 IFGMTNDMLMNRVFFVFDKDGDGYVNLEEWIKGLAVFLRGTFEEKMRFCFEVYYLNGDAYISQEK 124

  Fly   132 VVGVAIEQFFTGDDDDEVNELRADMCEFIFGKFDTDKDGVIAFEEYAEIVQNQPGLLEFLGKIFP 196
            :..:.....|....::|..|...|:.|....|.|.|.||.|:|.::.:.|:....|||..|...|
Mouse   125 IFDMLKSSLFQHSPEEENEEGVKDLVEISLKKMDYDNDGKISFADFEKAVKEDGLLLEAFGPCLP 189

  Fly   197 DDKDRSLVAYCHNIESMF----PPEGL 219
            |.|      :|.:.|::.    ||..|
Mouse   190 DAK------FCFHFEALVFKNNPPASL 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sunzNP_649673.1 EF-hand_7 113..181 CDD:290234 20/68 (29%)
1700109H08RikNP_084119.1 EFh 71..130 CDD:298682 18/58 (31%)
EF-hand_7 105..174 CDD:290234 20/68 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833420
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.900

Return to query results.
Submit another query.