DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sunz and Cib4

DIOPT Version :9

Sequence 1:NP_649673.1 Gene:sunz / 40811 FlyBaseID:FBgn0037462 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_001068424.2 Gene:Cib4 / 688819 RGDID:1584147 Length:185 Species:Rattus norvegicus


Alignment Length:169 Identity:32/169 - (18%)
Similarity:70/169 - (41%) Gaps:11/169 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IKSFAASTEFSTNEVVSLLIVFYKY---ALNNRSRMMSTSQLYNLFLVSFGIFDVTIIDRISMNI 85
            ::.:.|.|..:.||::.:...|.|.   ..:.:...::..|:.:|..:....|.    |||....
  Rat    14 LEEYQALTFLTRNEILCIHDTFLKLCPPGKHYKEATLTMDQVSSLPALRVNPFR----DRICRVF 74

  Fly    86 TQDGRSVSPEAWMRLFCVFFNGSLQE-RMKFAFEVYTSGGAVVLNREVVGVAIEQFFTGDDDDEV 149
            :.|. ..|.|..:.:..||...:... ::::||.:|.......::.|.:...:.:....||..| 
  Rat    75 SHDD-VFSFEDVLGMASVFSEQACPSLKIEYAFRIYDFNENGFIDEEDLQKIVLRLLKSDDVSE- 137

  Fly   150 NELRADMCEFIFGKFDTDKDGVIAFEEYAEIVQNQPGLL 188
             :|..|:...:..:.|.|.|.:::|.|:...:...|..:
  Rat   138 -DLLQDVTHHVLSESDLDNDNMLSFSEFEHAMAKSPDFM 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sunzNP_649673.1 EF-hand_7 113..181 CDD:290234 14/67 (21%)
Cib4XP_001068424.2 FRQ1 21..173 CDD:227455 30/158 (19%)
EF-hand_7 101..168 CDD:404394 14/68 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.