DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sunz and Chp1

DIOPT Version :9

Sequence 1:NP_649673.1 Gene:sunz / 40811 FlyBaseID:FBgn0037462 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_077053.1 Gene:Chp1 / 64152 RGDID:620447 Length:195 Species:Rattus norvegicus


Alignment Length:142 Identity:30/142 - (21%)
Similarity:49/142 - (34%) Gaps:47/142 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 FNGSLQERMKFAFEVYTSGGAVVLNRE-----------VVGVAIEQFFTGDDDDEVN-------- 150
            |:.|...|:...|.....|....|:||           .:|..|...|..:.:|:||        
  Rat    23 FSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFSEGEDQVNFRGFMRTL 87

  Fly   151 ---------------------ELRADMCEFIFGKFDTDKDGVIAFEEYAEIVQNQPGLL---EFL 191
                                 ..|::...|.|..:|.|||..|:.:|..::::...|:.   |.|
  Rat    88 AHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDDKISRDELLQVLRMMVGVNISDEQL 152

  Fly   192 GKIFPDDKDRSL 203
            |.|    .||::
  Rat   153 GSI----ADRTI 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sunzNP_649673.1 EF-hand_7 113..181 CDD:290234 20/107 (19%)
Chp1NP_077053.1 FRQ1 1..182 CDD:227455 30/142 (21%)
Necessary for association with microtubule and interaction with GAPDH 2..6
Nuclear export signal 1 138..147 1/8 (13%)
Nuclear export signal 2 176..185
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.