powered by:
Protein Alignment sunz and TESC
DIOPT Version :9
Sequence 1: | NP_649673.1 |
Gene: | sunz / 40811 |
FlyBaseID: | FBgn0037462 |
Length: | 220 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_016875021.1 |
Gene: | TESC / 54997 |
HGNCID: | 26065 |
Length: | 251 |
Species: | Homo sapiens |
Alignment Length: | 65 |
Identity: | 22/65 - (33%) |
Similarity: | 34/65 - (52%) |
Gaps: | 5/65 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 122 SGGAVVLNREVVGVAIEQFF----TGDDDDEVNELRADMCEFIFGKFDTDKDGVIAFEEYAEIVQ 182
||.|..:|.|.. :.|..:| |..|:::|...|.:...|:|..:|:|.||.|..|||..:|:
Human 130 SGLADEINFEDF-LTIMSYFRPIDTTMDEEQVELSRKEKLRFLFHMYDSDSDGRITLEEYRNVVE 193
Fly 183 182
Human 194 193
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG0034 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.