DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sunz and efcab1

DIOPT Version :9

Sequence 1:NP_649673.1 Gene:sunz / 40811 FlyBaseID:FBgn0037462 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001016778.1 Gene:efcab1 / 549532 XenbaseID:XB-GENE-5727529 Length:208 Species:Xenopus tropicalis


Alignment Length:209 Identity:61/209 - (29%)
Similarity:94/209 - (44%) Gaps:27/209 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNRIDLTLDDMANNKFLTMYSTLIKSFAASTEFSTNEVVSLLIVFYKYALN----NRSRMMSTSQ 61
            |||.:|       .|.....|.|||      .||.|||.||:.:::.....    |..|.:..:.
 Frog     1 MNRKNL-------QKQADALSRLIK------HFSKNEVESLIRLYHTLVGRPIDPNTRRGIDRNT 52

  Fly    62 LYNLFLVSFGIFDVTIIDRISMNITQDGRS-VSPEAWMRLFCVFFNGSLQERMKFAFEVYTSGGA 125
            ..|:...:||:.|..|:||:.....:|..| :|...|:....||..|:|:||:|:.|.||...|.
 Frog    53 FRNILHNTFGMTDDMIMDRVFRGFDKDNDSYISVTEWVEGLSVFLRGTLEERIKYCFGVYDLNGD 117

  Fly   126 VVLNRE-----VVGVAIEQFFTGDDDDEVNELRADMCEFIFGKFDTDKDGVIAFEEYAEIVQNQP 185
            ..::||     :....::|....|.|:.|.    |:.|....|.|.|.|..:::.::.:.||.:.
 Frog   118 GYISREEMFHMLKNSLLKQPSEEDPDEGVK----DLVEIALKKMDYDHDSKLSYMDFEKAVQEEN 178

  Fly   186 GLLEFLGKIFPDDK 199
            .|||..|...||.|
 Frog   179 LLLEAFGPCLPDSK 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sunzNP_649673.1 EF-hand_7 113..181 CDD:290234 17/72 (24%)
efcab1NP_001016778.1 EF-hand_7 69..129 CDD:290234 19/59 (32%)
EFh 71..130 CDD:238008 18/58 (31%)
EFh 104..175 CDD:238008 18/74 (24%)
EF-hand_7 105..174 CDD:290234 17/72 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1331864at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.