DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sunz and LOC500007

DIOPT Version :9

Sequence 1:NP_649673.1 Gene:sunz / 40811 FlyBaseID:FBgn0037462 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_006236139.1 Gene:LOC500007 / 500007 RGDID:1588445 Length:217 Species:Rattus norvegicus


Alignment Length:198 Identity:58/198 - (29%)
Similarity:98/198 - (49%) Gaps:13/198 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LIKSFAASTE-FSTNEVVSLLIVFYKYALNNRSRMMSTSQLYNLF---LVS-FGIFDVTIIDRIS 82
            |::||..:.: |...||..|:.:||..|.....::.:|....|.|   |.: ||:.:..:::|:.
  Rat     9 LVESFRKTVKCFKKFEVECLIQLFYSLAGCPIGKVDNTKLDCNAFRGVLQNFFGMTNDVLMNRVF 73

  Fly    83 MNITQDGRS-VSPEAWMRLFCVFFNGSLQERMKFAFEV-YTSGGAVVLNREVVGVAIEQFFTGDD 145
            ....:||.| |:.:.|::...||..|:.:|:|:|.||| |.||.|.:...::..:.....|....
  Rat    74 FVFDKDGDSHVNLQEWIKGLAVFLRGTFEEKMRFCFEVYYLSGDAYISREKIFDMLKSSLFHNSP 138

  Fly   146 DDEVNELRADMCEFIFGKFDTDKDGVIAFEEYAEIVQNQPGLLEFLGKIFPDDKDRSLVAYCHNI 210
            ::|..|...|:.|....|.|.|.||.|:||::.:.|:....|||..|...||.|.      |.:.
  Rat   139 EEENEEGIKDLVEISLKKMDYDNDGKISFEDFEKAVRKDGLLLEAFGPCLPDAKT------CFHF 197

  Fly   211 ESM 213
            |::
  Rat   198 EAL 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sunzNP_649673.1 EF-hand_7 113..181 CDD:290234 22/68 (32%)
LOC500007XP_006236139.1 EFh 104..175 CDD:298682 22/70 (31%)
EF-hand_7 105..174 CDD:290234 22/68 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336975
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1331864at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.910

Return to query results.
Submit another query.