DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sunz and cib1

DIOPT Version :9

Sequence 1:NP_649673.1 Gene:sunz / 40811 FlyBaseID:FBgn0037462 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001011480.1 Gene:cib1 / 496971 XenbaseID:XB-GENE-970951 Length:190 Species:Xenopus tropicalis


Alignment Length:178 Identity:44/178 - (24%)
Similarity:79/178 - (44%) Gaps:18/178 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LIKSFAASTEFSTNEVVSLLIVFYKYA-LNNRSRMMS----TSQLYNLFLVSFGIFDVTIIDRIS 82
            ||..:...|..:..|::.....|.:.| .:|||.:.|    ..:..||..:....|:..|....|
 Frog    12 LINEYQELTYLTKQEIILAYKRFSEVAQKDNRSNIESLRIPKERFLNLPELKANPFNDRICTVFS 76

  Fly    83 MNITQDGRSVSPEAWMRLFCVFF-NGSLQERMKFAFEVYTSGGAVVLNREVVGVAIEQFFTGDDD 146
            .:..:|| |:|.|.::.:...|. :.:|:.:..:||.::...|...||...:...:.: .|||.|
 Frog    77 TSEQEDG-SMSFEDFLDMLSAFSESATLEVKSHYAFRIFDFDGDGALNESDLEHLVNK-LTGDKD 139

  Fly   147 D------EVNELRADMCEFIFGKFDTDKDGVIAFEEYAEIVQNQPGLL 188
            |      |:.:|.|::.|    :.|.||||.|...|:..::...|..:
 Frog   140 DTKLSNSEMRQLIANILE----ESDIDKDGTINHSEFQHVISRSPDFI 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sunzNP_649673.1 EF-hand_7 113..181 CDD:290234 21/73 (29%)
cib1NP_001011480.1 FRQ1 20..181 CDD:227455 41/166 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.