DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sunz and CG5890

DIOPT Version :9

Sequence 1:NP_649673.1 Gene:sunz / 40811 FlyBaseID:FBgn0037462 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster


Alignment Length:132 Identity:33/132 - (25%)
Similarity:56/132 - (42%) Gaps:33/132 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 SQLYNLFLVSFGIFDVTIIDRISMN---ITQDGRSVSPEAWMRLFCVFFNGSLQERMKFAFEVYT 121
            |.||..::  |..|||.....||..   :|              ......||:.||:::.|::|.
  Fly    77 SSLYAHYV--FKAFDVNCNGAISFRDLLVT--------------LSTLLRGSVYERLRWTFKLYD 125

  Fly   122 SGGAVVLNR----EVVGVAIEQFF-----TGDDDDEVNELRADMCEFIFGKFDTDKDGVIAFEEY 177
            ..|...::|    |:: :||.:..     ..:||.:..    |..:.:|.|.|.::||:|..||:
  Fly   126 LNGDGRISRGELSEII-LAIHELMGRRPHQPEDDRKAR----DQVDRVFRKLDLNQDGIITIEEF 185

  Fly   178 AE 179
            .|
  Fly   186 LE 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sunzNP_649673.1 EF-hand_7 113..181 CDD:290234 19/76 (25%)
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 33/132 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442297
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.