DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sunz and d-cup

DIOPT Version :9

Sequence 1:NP_649673.1 Gene:sunz / 40811 FlyBaseID:FBgn0037462 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_650235.1 Gene:d-cup / 41580 FlyBaseID:FBgn0038089 Length:219 Species:Drosophila melanogaster


Alignment Length:218 Identity:86/218 - (39%)
Similarity:137/218 - (62%) Gaps:4/218 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RIDLTLDDMANNKFLTMYSTLIKSFAASTEFSTNEVVSLLIVFYKYALNN--RSRMMSTSQLYNL 65
            ::|||::|..|.:|.::|..|:...|....|:.:||..:|:::|||:|.|  .:|.:::||..|:
  Fly     2 KLDLTMNDRFNQRFQSVYGGLVPQIARLVPFNDSEVTCILMIYYKYSLQNGPSARRITSSQFVNI 66

  Fly    66 FLVSFGIFDVTIIDRISMNITQDGRSVSPEAWMRLFCVFFNGSLQERMKFAFEVYTSGGAVVLNR 130
            .:....::|:.::|||...|....:.|:|..::....:..:..::.:|:||:.||...| :.:||
  Fly    67 VIGFQQLYDMDVVDRIVTLIAGGRKHVTPMEFVNYMTILMSRDMERKMEFAYMVYDKNG-MGINR 130

  Fly   131 EVVGVAIEQFFTGDDDDEVNELRADMCEFIFGKFDTDKDGVIAFEEYAEIVQNQPGLLEFLGKIF 195
            |::..::|:||.| |||||.|:|.||.:|:..|||.|:||.|:||||..||..||.||||||.||
  Fly   131 EIISSSVERFFVG-DDDEVLEMRLDMVDFLLLKFDEDQDGYISFEEYRSIVLQQPRLLEFLGPIF 194

  Fly   196 PDDKDRSLVAYCHNIESMFPPEG 218
            |.|:.|.:||||..|.|..|..|
  Fly   195 PSDETRLVVAYCTAIYSHIPEMG 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sunzNP_649673.1 EF-hand_7 113..181 CDD:290234 34/67 (51%)
d-cupNP_650235.1 EF-hand_7 114..180 CDD:290234 34/67 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438933
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Homologene 1 1.000 - - H51492
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27167
OrthoDB 1 1.010 - - D106617at6656
OrthoFinder 1 1.000 - - FOG0012682
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X7637
98.860

Return to query results.
Submit another query.