DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sunz and sowi

DIOPT Version :9

Sequence 1:NP_649673.1 Gene:sunz / 40811 FlyBaseID:FBgn0037462 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_649671.2 Gene:sowi / 40809 FlyBaseID:FBgn0037460 Length:217 Species:Drosophila melanogaster


Alignment Length:213 Identity:96/213 - (45%)
Similarity:148/213 - (69%) Gaps:2/213 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNRIDLTLDDMANNKFLTMYSTLIKSFAASTEFSTNEVVSLLIVFYKYALNN--RSRMMSTSQLY 63
            |..:|.|:|.|.|::|..:|.:|||....::|.|..::..||:|:||::..|  :.:.|:..|.|
  Fly     1 MENLDATIDSMENSRFAALYGSLIKELTLTSELSQTDITCLLVVYYKFSKANGPQCKQMTKKQFY 65

  Fly    64 NLFLVSFGIFDVTIIDRISMNITQDGRSVSPEAWMRLFCVFFNGSLQERMKFAFEVYTSGGAVVL 128
            .:|||.|.:..|.:|:|..:.||:|.:.|||.||:.||.::....:|.||:||||||.:.|..|:
  Fly    66 QIFLVLFNVASVQVIERTLLAITKDTKYVSPRAWIHLFDLYTTNDIQVRMRFAFEVYDTKGTGVI 130

  Fly   129 NREVVGVAIEQFFTGDDDDEVNELRADMCEFIFGKFDTDKDGVIAFEEYAEIVQNQPGLLEFLGK 193
            :||.||.|.|:||.|:|:||:|||:|||.||:..|||.||||||::|:|:.:|:.||.|:||||.
  Fly   131 DREQVGTACEKFFYGEDEDELNELKADMTEFLMKKFDLDKDGVISYEDYSTVVEQQPILVEFLGW 195

  Fly   194 IFPDDKDRSLVAYCHNIE 211
            :||..:|:.|:|:|.|::
  Fly   196 LFPSKEDKDLMAHCINLQ 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sunzNP_649673.1 EF-hand_7 113..181 CDD:290234 40/67 (60%)
sowiNP_649671.2 EF-hand_7 115..179 CDD:290234 39/63 (62%)
EFh 116..178 CDD:238008 37/61 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438927
Domainoid 1 1.000 58 1.000 Domainoid score I17891
eggNOG 1 0.900 - - E2759_KOG0034
Homologene 1 1.000 - - H51492
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27167
OrthoDB 1 1.010 - - D106617at6656
OrthoFinder 1 1.000 - - FOG0012682
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X7637
109.860

Return to query results.
Submit another query.