DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sunz and Nca

DIOPT Version :9

Sequence 1:NP_649673.1 Gene:sunz / 40811 FlyBaseID:FBgn0037462 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_788543.1 Gene:Nca / 40186 FlyBaseID:FBgn0013303 Length:190 Species:Drosophila melanogaster


Alignment Length:190 Identity:39/190 - (20%)
Similarity:76/190 - (40%) Gaps:39/190 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LIKSFAASTEFSTNEVVSLLIVFYKYALNNRSRMMSTSQLYNLFLV----------SFGIFDVTI 77
            :::....:|||:..|:......|.|...:....:....::|..|..          .|..||.  
  Fly    12 VLEDLKQNTEFTDAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFAEHVFRTFDA-- 74

  Fly    78 IDRISMNITQDGRSVSPEAWMRLFCVFFNGSLQERMKFAFEVYTSGGAVVLNRE----------- 131
                    ..|| ::....::....|...|.|::::|:||.:|...|...::|:           
  Fly    75 --------NGDG-TIDFREFLCALSVTSRGKLEQKLKWAFSMYDLDGNGYISRQEMLEIVTAIYK 130

  Fly   132 VVGVAIEQFFTGDDDDEVNELRADMCEFIFGKFDTDKDGVIAFEEYAEIVQNQPGLLEFL 191
            :||..::.    .:|:...|.|.|.   ||.:.|.:|||.::.||:.|..::.|.::..|
  Fly   131 MVGSVMKM----PEDESTPEKRTDK---IFRQMDRNKDGKLSLEEFIEGAKSDPSIVRLL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sunzNP_649673.1 EF-hand_7 113..181 CDD:290234 21/78 (27%)
NcaNP_788543.1 FRQ1 13..179 CDD:227455 38/183 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442310
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.