DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sunz and Efcab1

DIOPT Version :9

Sequence 1:NP_649673.1 Gene:sunz / 40811 FlyBaseID:FBgn0037462 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_001100400.1 Gene:Efcab1 / 301957 RGDID:1594548 Length:212 Species:Rattus norvegicus


Alignment Length:196 Identity:52/196 - (26%)
Similarity:87/196 - (44%) Gaps:10/196 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 MANNKFLTMYSTLIKSFAASTEFSTNEVVSLLIVFYKYALNNRSRM-----MSTSQLYNLFLVSF 70
            |...|...:..||.||   ...|:..||..|:.:||....:...:.     :..:...|:..|:|
  Rat     1 MNRKKLQKLTDTLTKS---CKHFNKFEVKCLITLFYNLVGDVPEKPGVVTGLDRNVFRNILHVTF 62

  Fly    71 GIFDVTIIDRISMNITQDGRS-VSPEAWMRLFCVFFNGSLQERMKFAFEVY-TSGGAVVLNREVV 133
            |:.|..|:||:.....:|... :|...|:....:|..|:|.|:||:.|||: .:|...:...|:.
  Rat    63 GMTDDMIMDRVFRGFDRDNDGCISVSEWVHGLSLFLRGTLDEKMKYCFEVFDLNGDGFISKEEMF 127

  Fly   134 GVAIEQFFTGDDDDEVNELRADMCEFIFGKFDTDKDGVIAFEEYAEIVQNQPGLLEFLGKIFPDD 198
            .:..........:::.:|...|:.|....|.|.|.||.::|.:|...|:.:..|||..|...||.
  Rat   128 HMLKNSLLKQPSEEDPDEGIKDLVEITLKKMDHDHDGKLSFVDYETAVREETLLLEAFGPCLPDP 192

  Fly   199 K 199
            |
  Rat   193 K 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sunzNP_649673.1 EF-hand_7 113..181 CDD:290234 17/68 (25%)
Efcab1NP_001100400.1 EF-hand_7 70..130 CDD:290234 16/59 (27%)
EFh 72..131 CDD:238008 15/58 (26%)
EFh 105..168 CDD:238008 15/62 (24%)
EF-hand_7 106..175 CDD:290234 17/68 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1331864at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.