DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sunz and Tesc

DIOPT Version :9

Sequence 1:NP_649673.1 Gene:sunz / 40811 FlyBaseID:FBgn0037462 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_006249488.1 Gene:Tesc / 288689 RGDID:1566317 Length:247 Species:Rattus norvegicus


Alignment Length:179 Identity:40/179 - (22%)
Similarity:79/179 - (44%) Gaps:36/179 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IKSFAASTEFSTNEVVSLLIVFYKYALNNRSRMMSTSQLYNLFLVSFGIFDVTIIDRISMNITQD 88
            ::.....|.||::::..|...|.:.:.:..:..:.:|:|.::..||     |....::.:::...
  Rat    11 VRELEGKTGFSSDQIEQLHRRFKQLSGDQPTIRLCSSRLCSVRSVS-----VPPTSQLPLSVKLQ 70

  Fly    89 GRSV-SPEAW---------------MRLFCVFFNGSLQERMKFAFEVYTSGGAVVLNREVVGVAI 137
            .|.| |.|.:               :|.|  |.|.:|::.        :||.|..:|.|.. :.|
  Rat    71 WRPVCSKENFNNVPDLELNPIRSKIVRAF--FDNRNLRKG--------SSGLADEINFEDF-LTI 124

  Fly   138 EQFFTGDD----DDEVNELRADMCEFIFGKFDTDKDGVIAFEEYAEIVQ 182
            ..:|...|    :::|...|.:..:|:|..:|:|.||.|..|||..:|:
  Rat   125 MSYFRPIDTTLGEEQVELSRKEKLKFLFHMYDSDSDGRITLEEYRNVVE 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sunzNP_649673.1 EF-hand_7 113..181 CDD:290234 20/71 (28%)
TescXP_006249488.1 EFh 147..>175 CDD:298682 11/27 (41%)
EF-hand_7 148..223 CDD:290234 11/26 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.