DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sunz and Cib1

DIOPT Version :9

Sequence 1:NP_649673.1 Gene:sunz / 40811 FlyBaseID:FBgn0037462 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_036000.1 Gene:Cib1 / 23991 MGIID:1344418 Length:191 Species:Mus musculus


Alignment Length:133 Identity:31/133 - (23%)
Similarity:62/133 - (46%) Gaps:8/133 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 MSTSQLYNLFLVSFGIFDVTIIDRISMNITQDGRSVSPEAWMRLFCVFFNGSLQE-RMKFAFEVY 120
            :|..|:.:|..:....|...|....|.:.|:|  |:|.|.::.|..||.:.:..: :..:||.::
Mouse    53 VSFEQILSLPELKANPFKERICMVFSTSPTRD--SLSFEDFLDLLSVFSDTATPDIKSHYAFRIF 115

  Fly   121 TSGGAVVLNREVVGVAIEQFFTGDDDD---EVNELRADMCEFIFGKFDTDKDGVIAFEEYAEIVQ 182
            .......|:||.:...: ...||:.:|   ..:|:: .:.:.|..:.|.|:||.|...|:..::.
Mouse   116 DFDDDGTLDREDLSQLV-NCLTGEGEDTRLSASEMK-QLIDNILEESDIDRDGTINLSEFQHVIS 178

  Fly   183 NQP 185
            ..|
Mouse   179 RSP 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sunzNP_649673.1 EF-hand_7 113..181 CDD:290234 16/70 (23%)
Cib1NP_036000.1 EFh 111..178 CDD:238008 16/68 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.