DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sunz and Ppp3r1

DIOPT Version :9

Sequence 1:NP_649673.1 Gene:sunz / 40811 FlyBaseID:FBgn0037462 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_077779.2 Gene:Ppp3r1 / 19058 MGIID:107172 Length:170 Species:Mus musculus


Alignment Length:186 Identity:44/186 - (23%)
Similarity:70/186 - (37%) Gaps:48/186 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 TEFSTNEVVSLLIVFYKYALNNRSRM-----MSTSQLYNLFLVS--FGIFDVTIIDRISMNITQD 88
            :.|..:|:..|...|.|..|:|...:     ||..:|....||.  ..|||......:......:
Mouse    13 SHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIE 77

  Fly    89 GRSVSPEAWMRLFCVFFNGSLQERMKFAFEVY--------TSGGAVVLNREVVGVAIEQFFTGDD 145
            |.|        .|.|  .|..:::::|||.:|        ::|....:.:.:||           
Mouse    78 GVS--------QFSV--KGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVG----------- 121

  Fly   146 DDEVNELRADMCEFIFGK----FDTDKDGVIAFEEYAEIVQNQPGLLEFLGKIFPD 197
                |.|:....:.|..|    .|.|.||.|:|||:..:|    |.|:...|:..|
Mouse   122 ----NNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVV----GGLDIHKKMVVD 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sunzNP_649673.1 EF-hand_7 113..181 CDD:290234 19/79 (24%)
Ppp3r1NP_077779.2 FRQ1 13..157 CDD:227455 39/168 (23%)
Calcineurin A binding. /evidence=ECO:0000269|PubMed:26794871 131..136 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.