DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sunz and pbo-1

DIOPT Version :9

Sequence 1:NP_649673.1 Gene:sunz / 40811 FlyBaseID:FBgn0037462 Length:220 Species:Drosophila melanogaster
Sequence 2:NP_497601.1 Gene:pbo-1 / 175385 WormBaseID:WBGene00003941 Length:196 Species:Caenorhabditis elegans


Alignment Length:97 Identity:21/97 - (21%)
Similarity:41/97 - (42%) Gaps:28/97 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 PEAWMRLFCVFFNGSLQERMKFAFEVYTSGGAVVLNRE--------VVGVAIEQFFTGDDDDEVN 150
            |..|         .|.:.:::|||.:|....:..:.::        ::||.:.:       |:||
 Worm   106 PHPW---------NSREAKLRFAFTMYDLNKSGTITKDEFQDILAMMIGVGVPK-------DQVN 154

  Fly   151 ELRADMCEFIFGKFDTDKDGVIAFEEYAEIVQ 182
            .: ||.   ...:.|.|.||.|.|:|:...::
 Worm   155 SI-ADR---TMREADRDGDGFITFQEFCNAME 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sunzNP_649673.1 EF-hand_7 113..181 CDD:290234 18/75 (24%)
pbo-1NP_497601.1 EFh 115..181 CDD:238008 18/76 (24%)
EF-hand_7 116..181 CDD:290234 18/75 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.