Sequence 1: | NP_649673.1 | Gene: | sunz / 40811 | FlyBaseID: | FBgn0037462 | Length: | 220 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011530816.1 | Gene: | CIB4 / 130106 | HGNCID: | 33703 | Length: | 201 | Species: | Homo sapiens |
Alignment Length: | 198 | Identity: | 39/198 - (19%) |
---|---|---|---|
Similarity: | 72/198 - (36%) | Gaps: | 37/198 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MNRIDLT--------LDDMANNKFLTMYSTLIKSFAASTEFSTNEVVSLLIVFYKYALNNRSRMM 57
Fly 58 STSQL-YNLFLVSFGIFDVTIIDRISMNITQDGRSVSPEAWMRLFCVFFNGSLQE-RMKFAFEVY 120
Fly 121 TSGGAVVLNREVVGVAIEQFFTGDDDDEVNELRADMCEFIFGKFDTDKDGVIAFEEYAEIVQNQP 185
Fly 186 GLL 188 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sunz | NP_649673.1 | EF-hand_7 | 113..181 | CDD:290234 | 15/67 (22%) |
CIB4 | XP_011530816.1 | EFh | 117..185 | CDD:238008 | 15/69 (22%) |
EF-hand_7 | 118..184 | CDD:290234 | 15/67 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0034 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |