DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sunz and CIB4

DIOPT Version :9

Sequence 1:NP_649673.1 Gene:sunz / 40811 FlyBaseID:FBgn0037462 Length:220 Species:Drosophila melanogaster
Sequence 2:XP_011530816.1 Gene:CIB4 / 130106 HGNCID:33703 Length:201 Species:Homo sapiens


Alignment Length:198 Identity:39/198 - (19%)
Similarity:72/198 - (36%) Gaps:37/198 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNRIDLT--------LDDMANNKFLTMYSTLIKSFAASTEFSTNEVVSLLIVFYKYALNNRSRMM 57
            ||.:|.:        |..:..|:.|.::.|.:|......             :||.|.....::.
Human    21 MNGVDTSLLCDLLQALTFLTRNEILCIHDTFLKLCPPGK-------------YYKEATLTMDQVS 72

  Fly    58 STSQL-YNLFLVSFGIFDVTIIDRISMNITQDGRSVSPEAWMRLFCVFFNGSLQE-RMKFAFEVY 120
            |...| .|.|.           |||....:..| ..|.|..:.:..||...:... ::::||.:|
Human    73 SLPALRVNPFR-----------DRICRVFSHKG-MFSFEDVLGMASVFSEQACPSLKIEYAFRIY 125

  Fly   121 TSGGAVVLNREVVGVAIEQFFTGDDDDEVNELRADMCEFIFGKFDTDKDGVIAFEEYAEIVQNQP 185
            .......::.|.:...|.:....||..|  :|..|:...:..:.|.|.|.:::|.|:...:...|
Human   126 DFNENGFIDEEDLQRIILRLLNSDDMSE--DLLMDLTNHVLSESDLDNDNMLSFSEFEHAMAKSP 188

  Fly   186 GLL 188
            ..:
Human   189 DFM 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sunzNP_649673.1 EF-hand_7 113..181 CDD:290234 15/67 (22%)
CIB4XP_011530816.1 EFh 117..185 CDD:238008 15/69 (22%)
EF-hand_7 118..184 CDD:290234 15/67 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.